Greetings GenBank Users,
GenBank Release 218.0 is now available via FTP from the National Center
for Biotechnology Information (NCBI):
Ftp Site Directory Contents
---------------- --------- ---------------------------------------
ftp.ncbi.nih.gov genbank GenBank Release 218.0 flatfiles
ncbi-asn1 ASN.1 data used to create Release 218.0
Close-of-data for GenBank 218.0 occurred on 02/13/2017. Uncompressed,
the Release 218.0 flatfiles require roughly 818 GB (sequence files only).
The ASN.1 data require approximately 677 GB.
Recent statistics for 'traditional' sequences (including non-bulk-oriented
TSA, and excluding WGS, bulk-oriented TSA, TLS, and the CON-division):
Release Date Base Pairs Entries
217 Dec 2016 224973060433 198565475
218 Feb 2017 228719437638 199341377
Recent statistics for WGS sequencing projects:
Release Date Base Pairs Entries
217 Dec 2016 1817189565845 395301176
218 Feb 2017 1892966308635 409490397
Recent statistics for bulk-oriented TSA sequencing projects:
Release Date Base Pairs Entries
217 Dec 2016 125328824508 142094337
218 Feb 2017 133517212104 151431485
Recent statistics for bulk-oriented TLS sequencing projects:
Release Date Base Pairs Entries
217 Dec 2016 584697919 1268690
218 Feb 2017 636923295 1438349
During the 60 days between the close dates for GenBank Releases 217.0
and 218.0, the 'traditional' portion of GenBank grew by 3,746,377,205
basepairs and by 775,902 sequence records. During that same period,
68,617 records were updated. An average of 14,075 'traditional' records
were added and/or updated per day.
Between releases 217.0 and 218.0, the WGS component of GenBank grew by
75,776,742,790 basepairs and by 14,189,221 sequence records.
Between releases 217.0 and 218.0, the TSA component of GenBank grew by
8,188,387,596 basepairs and by 9,337,148 sequence records.
Between releases 217.0 and 218.0, the TLS component of GenBank grew by
52,225,376 basepairs and by 169,659 sequence records.
For additional release information, see the README files in either of
the directories mentioned above, and the release notes (gbrel.txt) in
the genbank directory. Sections 1.3 and 1.4 of the release notes
(Changes in Release 218.0 and Upcoming Changes) have been appended
below for your convenience.
* * * IMPORTANT * * *
A significant change is described in Section 1.4.1 of the release
notes: Removal of NCBI GI sequence identifiers from GenBank, GenPept,
and FASTA sequence formats. Users who make use of GIs in their information
systems and analysis pipelines should take particular note of that section.
Implementation of this change for GenBank Release and Update FTP
products will take place on March 15 2017. GIs are already no longer
displayed via NCBI's Entrez retrieval system.
* * * IMPORTANT * * *
Release 218.0 data, and subsequent updates, are available now via
NCBI's Entrez and Blast services.
As a general guideline, we suggest first transferring the GenBank
release notes (gbrel.txt) whenever a release is being obtained. Check
to make sure that the date and release number in the header of the
release notes are current (eg: February 15 2017, 218.0). If they are
not, interrupt the remaining transfers and then request assistance from
the NCBI Service Desk.
A comprehensive check of the headers of all release files after your
transfers are complete is also suggested. Here's how one might go about
this on a Unix or Linux platform, using csh/tcsh :
set files = `ls gb*.*`
foreach i ($files)
head -10 $i | grep Release
end
Or, if the files are compressed, perhaps:
gzcat $i | head -10 | grep Release
If you encounter problems while ftp'ing or uncompressing Release
218.0, please send email outlining your difficulties to:
info from ncbi.nlm.nih.gov
Mark Cavanaugh, Michael Kimelman, Ilya Dondoshansky, Sergey Zhdanov,
GenBank
NCBI/NLM/NIH/HHS
1.3 Important Changes in Release 218.0
1.3.1 Organizational changes
The total number of sequence data files increased by 39 with this release:
- the BCT division is now composed of 330 files (+26)
- the CON division is now composed of 356 files (-1)
- the ENV division is now composed of 95 files (+1)
- the INV division is now composed of 152 files (+1)
- the PAT division is now composed of 283 files (+3)
- the PLN division is now composed of 143 files (+6)
- the VRL division is now composed of 47 files (+2)
- the VRT division is now composed of 64 files (+1)
The number of CON division files decreased due to the re-assembly or
re-submission of underlying WGS projects, and to the suppression of an
incomplete genome assembly, impacting approximately 142,000 records:
File Accession Range Records
------ ----------------- -------
con166 HG826010-HG850177 24168
con167 HG850178-HG915294 65117
con241 KI478696-KI503496 24801
con242 KI503497-KI515612 12116
con353 LN913085-LN929547 16463
1.3.2 GSS File Header Problem
GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped by the first, it does not know how to number its own
output files.
There is thus a discrepancy between the filenames and file headers for 130
of the GSS flatfiles in Release 218.0. Consider gbgss174.seq :
GBGSS1.SEQ Genetic Sequence Data Bank
February 15 2017
NCBI-GenBank Flat File Release 218.0
GSS Sequences (Part 1)
87032 loci, 63853715 bases, from 87032 reported sequences
Here, the filename and part number in the header is "1", though the file
has been renamed as "174" based on the number of files dumped from the other
system. We hope to resolve this discrepancy at some point, but the priority
is certainly much lower than many other tasks.
1.4 Upcoming Changes
1.4.1 GI sequence identifiers to be removed from GenBank/GenPept/FASTA formats
and FASTA header to be simplified
As of March 15 2017, the integer sequence identifiers known as "GIs" will
no longer be included in the GenBank, GenPept, and FASTA formats for GenBank
Release and GenBank Update products. The FASTA header will be further simplified,
to report only the sequence Accession.Version for records that originate within
the International Sequence Database Collaboration (INSDC).
******************************************************
** GenBank 218.0 is the FINAL release that includes **
** NCBI 'GI' sequence identifiers. **
******************************************************
As first described in the Release Notes for GenBank 199.0 in December 2013,
NCBI is in the process of moving to storage solutions which utilize only
Accession.Version identifiers. See Section 1.4.2 of these release notes for
additional background information about those developments.
Given this shift to non-GI-based systems, the importance of using
Accession.Version identifiers cannot be overstated. As early as October 2016,
NCBI will cease displaying GI identifiers in the flatfile and FASTA views
generated within the Entrez:Nucleotide and Entrez:Protein resources. So
any web-related processes solely dependent on GIs will need to be adjusted
before that time or they will cease to work.
Previously-assigned GI sequence identifiers will continue to exist
'behind the scenes', and NCBI services which accept GIs as inputs will
continue to be supported. NCBI will be adding support for Accession.Version
identifiers to any services that currently do not support them. As NCBI
makes this transition, we encourage any users who have workflows that
depend on GIs to begin planning to use Accession.Version identifiers instead.
The FASTA format will also be changed for all sequence records originating
within the INSDC, to report only the Accession.Version and the record title.
This will improve compatibility with other file types provided by NCBI and
others, including GFF3, Gene, and dbSNP download files. This FASTA format
change has already been made for the redesigned genomes FTP site based on
user requests to have a single consistent sequence identifier for both GFF3
and FASTA formats.
At this time, we plan to continue to provide database source information in
the FASTA header/definition line for non-INSDC sources of sequence data,
including UniProt, PDB structures, PIR, and Patent sequences.
Example 1 : An INSDC nucleotide record
In the sample record below, nucleotide sequence AF123456 was assigned a
GI of 6633795, and the protein translated from its coding region feature
was assigned a GI of 6633796 :
LOCUS AF123456 1510 bp mRNA linear VRT 12-APR-2012
DEFINITION Gallus gallus doublesex and mab-3 related transcription factor 1
(DMRT1) mRNA, partial cds.
ACCESSION AF123456
VERSION AF123456.2 GI:6633795
....
CDS <1..936
/gene="DMRT1"
/note="cDMRT1"
/codon_start=1
/product="doublesex and mab-3 related transcription factor
1"
/protein_id="AAF19666.1"
/db_xref="GI:6633796"
/translation="PAAGKKLPRLPKCARCRNHGYSSPLKGHKRFCMWRDCQCKKCSL
IAERQRVMAVQVALRRQQAQEEELGISHPVPLPSAPEPVVKKSSSSSSCLLQDSSSPA
HSTSTVAAAAASAPPEGRMLIQDIPSIPSRGHLESTSDLVVDSTYYSSFYQPSLYPYY
NNLYNYSQYQMAVATESSSSETGGTFVGSAMKNSLRSLPATYMSSQSGKQWQMKGMEN
RHAMSSQYRMCSYYPPTSYLGQGVGSPTCVTQILASEDTPSYSESKARVFSPPSSQDS
GLGCLSSSESTKGDLECEPHQEPGAFAVSPVLEGE"
As of March 15 2017, the Accession.Version will be the sole sequence
version identifier. The GI value on the VERSION line and the GI /db_xref
qualifier for the coding region feature will no longer be visible:
LOCUS AF123456 1510 bp mRNA linear VRT 12-APR-2012
DEFINITION Gallus gallus doublesex and mab-3 related transcription factor 1
(DMRT1) mRNA, partial cds.
ACCESSION AF123456
VERSION AF123456.2
....
CDS <1..936
/gene="DMRT1"
/note="cDMRT1"
/codon_start=1
/product="doublesex and mab-3 related transcription factor
1"
/protein_id="AAF19666.1"
/translation="PAAGKKLPRLPKCARCRNHGYSSPLKGHKRFCMWRDCQCKKCSL
IAERQRVMAVQVALRRQQAQEEELGISHPVPLPSAPEPVVKKSSSSSSCLLQDSSSPA
HSTSTVAAAAASAPPEGRMLIQDIPSIPSRGHLESTSDLVVDSTYYSSFYQPSLYPYY
NNLYNYSQYQMAVATESSSSETGGTFVGSAMKNSLRSLPATYMSSQSGKQWQMKGMEN
RHAMSSQYRMCSYYPPTSYLGQGVGSPTCVTQILASEDTPSYSESKARVFSPPSSQDS
GLGCLSSSESTKGDLECEPHQEPGAFAVSPVLEGE"
Example 2 : A GenPept record for an INSDC sequence
The current GenPept display format includes GI identifiers in the VERSION lines
(note that the coding region feature for GenPept has never included the display
of GI identifiers) :
LOCUS AAF19666 311 aa linear VRT 12-APR-2012
DEFINITION doublesex and mab-3 related transcription factor 1, partial [Gallus
gallus].
ACCESSION AAF19666
VERSION AAF19666.1 GI:6633796
DBSOURCE accession AF123456.2
....
CDS 1..311
/gene="DMRT1"
/coded_by="AF123456.2:<1..936"
As of March 15 2017, the VERSION line will no longer include the GI value:
LOCUS AAF19666 311 aa linear VRT 12-APR-2012
DEFINITION doublesex and mab-3 related transcription factor 1, partial [Gallus
gallus].
ACCESSION AAF19666
VERSION AAF19666.1
DBSOURCE accession AF123456.2
....
CDS 1..311
/gene="DMRT1"
/coded_by="AF123456.2:<1..936"
Example 3: FASTA format for an INSDC nucleotide and protein sequence
The current FASTA display, for most products, includes GI and database
source information (eg, 'gb' for GenBank, 'emb' for ENA, 'dbj' for
DDBJ), using the '|' character as a delimiter:
>gi|6633795|gb|AF123456.2| Gallus gallus doublesex and mab-3 related transcription factor 1 (DMRT1) mRNA, partial cds
CCGGCGGCGGGCAAGAAGCTGCCGCGTCTGCCCAAGTGTGCCCGCTGCCGCAACCACGGCTACTCCTCGC
CGCTGAAGGGGCACAAGCGGTTCTGCATGTGGCGGGACTGCCAGTGCAAGAAGTGCAGCCTGATCGCCGA
[....]
>gi|6633796|gb|AAF19666.1| doublesex and mab-3 related transcription factor 1, partial
[Gallus gallus]
PAAGKKLPRLPKCARCRNHGYSSPLKGHKRFCMWRDCQCKKCSLIAERQRVMAVQVALRRQQAQEEELGI
SHPVPLPSAPEPVVKKSSSSSSCLLQDSSSPAHSTSTVAAAAASAPPEGRMLIQDIPSIPSRGHLESTSD
LVVDSTYYSSFYQPSLYPYYNNLYNYSQYQMAVATESSSSETGGTFVGSAMKNSLRSLPATYMSSQSGKQ
WQMKGMENRHAMSSQYRMCSYYPPTSYLGQGVGSPTCVTQILASEDTPSYSESKARVFSPPSSQDSGLGC
LSSSESTKGDLECEPHQEPGAFAVSPVLEGE
As of March 15 2017, just the Accession.Version will be provided:
>AF123456.2 Gallus gallus doublesex and mab-3 related transcription factor 1 (DMRT1) mRNA, partial cds
CCGGCGGCGGGCAAGAAGCTGCCGCGTCTGCCCAAGTGTGCCCGCTGCCGCAACCACGGCTACTCCTCGC
CGCTGAAGGGGCACAAGCGGTTCTGCATGTGGCGGGACTGCCAGTGCAAGAAGTGCAGCCTGATCGCCGA
[....]
>AAF19666.1 doublesex and mab-3 related transcription factor 1, partial
[Gallus gallus]
PAAGKKLPRLPKCARCRNHGYSSPLKGHKRFCMWRDCQCKKCSLIAERQRVMAVQVALRRQQAQEEELGI
SHPVPLPSAPEPVVKKSSSSSSCLLQDSSSPAHSTSTVAAAAASAPPEGRMLIQDIPSIPSRGHLESTSD
LVVDSTYYSSFYQPSLYPYYNNLYNYSQYQMAVATESSSSETGGTFVGSAMKNSLRSLPATYMSSQSGKQ
WQMKGMENRHAMSSQYRMCSYYPPTSYLGQGVGSPTCVTQILASEDTPSYSESKARVFSPPSSQDSGLGC
LSSSESTKGDLECEPHQEPGAFAVSPVLEGE
Please direct any inquiries about these changes to the NCBI Service Desk:
info from ncbi.nlm.nih.gov
1.4.2 GI sequence identifiers are being phased out at NCBI
The numeric GI sequence identifier that NCBI used to assign to all
nucleotide and protein sequences was first introduced for GenBank Release
products as of GenBank 81.0, in February 1994. See:
ftp://ftp.ncbi.nih.gov/genbank/release.notes/gb81.release.notes
These simple, uniform, integer-based unique identifiers (which predated the
introduction of Accession.Version sequence identifiers) were crucial to the
development of NCBI's Entrez retrieval system, and have served their purpose
very well for over 20 years.
However, as NCBI considers how best to address the expected increase in the
volume of submitted sequence data, it is clear that prior practices will need
to be re-thought. As an example, imagine 100,000 pathogen-related
genomes/samples, each with 5000 proteins, most of which are common to all. We
will be moving toward solutions that represent each unique protein *once*.
The coding region protein products for each genome will likely continue to be
assigned their own Accession.Version identifiers, but (within the NCBI data
model) they will simply *reference* the unique proteins. And, they will no
longer be issued GIs of their own.
Such a change will likely have a significant impact on NCBI users who
utilize GIs in their own information systems and analysis pipelines, so it is
being implemented gradually. Unannotated WGS projects consisting of millions
of contigs and scaffolds, and unannotated TSA projects, are the first two
classes of records for which GIs are no longer being assigned. But the practice
will ultimately expand to include other classes of records.
If GIs are central to your operations, NCBI strongly urges that you begin
planning a switch to the use of Accession.Version identifiers instead.
The contigs and scaffolds of the ALWZ04 WGS project are good examples of
sequences that lack GIs. Below are excerpts from the flatfile representation
of the first ALWZ04 contig, and the 'singleton scaffold' which is constructed
from it. Note the absence of a GI value on the VERSION line of these two
records:
LOCUS ALWZ040000001 1191 bp DNA linear PLN 13-MAR-2015
DEFINITION Picea glauca, whole genome shotgun sequence.
ACCESSION ALWZ040000001 ALWZ040000000
VERSION ALWZ040000001.1
DBLINK BioProject: PRJNA83435
BioSample: SAMN01120252
....
ORIGIN
1 ctataatacc cctatgccaa acgaacccaa ttgtaaatgt aaatgcaaat gtacttaggc
61 tggttagttg tttaatatca ttttttgtat gcaccttcca tggtataatg cgcacatgta
121 tagcgcacta aaattatgaa gtgtgcccat tccaagatat tgcgcgtaaa aaacttaagt
181 gtgcatgatt ttgagactag ggagactttg tgtatatgtt gtgttttata tgctggagag
241 acaattatta ttagttagga ggattatgtt ttgtactagg caagagagcc tagatgttaa
301 aggctagtga gcctattttt gtatatgtct catcattaat ataatacatc attgtgtgta
....
901 ttgttgggaa ttgatttcct gaatgtgtta aactgcattg atagggatct gagaattcct
961 ttctggccta ttgctgaagc tttggaaggg aggtggggca accgagggac tgttgagaag
1021 agaagggtca cacttcctgg ggtgggacaa gcatgtgggg aattagggat tgcaggatgt
1081 tagtttgaat tggcacctat gacagagtct ttcctattgt ctgagatatg tcagcttggt
1141 taggaaaccc tttacctggg tagagtttag tcccagctcg ggggtgaccc a
//
LOCUS ALWZ04S0000001 1191 bp DNA linear CON 13-MAR-2015
DEFINITION Picea glauca Pg-01r141201s0000001, whole genome shotgun sequence.
ACCESSION ALWZ04S0000001 ALWZ0400000000
VERSION ALWZ04S0000001.1
DBLINK BioProject: PRJNA83435
BioSample: SAMN01120252
....
CONTIG join(ALWZ040000001.1:1..1191)
//
Sample URLs from which ALWZ04 data may be obtained include:
http://www.ncbi.nlm.nih.gov/Traces/wgs/?val=ALWZ04#contigshttp://www.ncbi.nlm.nih.gov/Traces/wgs/?val=ALWZ04#scaffoldshttp://www.ncbi.nlm.nih.gov/Traces/wgs/?download=ALWZ04.gbff.1.gzhttp://www.ncbi.nlm.nih.gov/Traces/wgs/?download=ALWZ04S.gbff.1.gzftp://ftp.ncbi.nlm.nih.gov/genbank/wgs/wgs.ALWZ.*.gbff.gzftp://ftp.ncbi.nlm.nih.gov/genbank/wgs/wgs.ALWZ.scflds.*.gbff.gz